Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Default DefaultDefault DefaultDefault DefaultDefault DefaultDefault Default
0 items
New Products
NIKE 4XLT TEES
2 product(s) found for "NIKE 4XLT TEES"
Nike Classic Screen Swoosh D..
Add To Cart
Nike Classic Screen Swoosh D..
Athletic cut and style are always a perfect fit with the Nike Screen Swoosh Dri-Fit Tee. This lightweight short sleeve tee shows off the classic Swoosh logo in screen-printed black contrast style. The athletic cut makes it a great tee for working out. Measurements: 31" chest, 37" length. Fabric: 60%...
$28.99
Details Add To Cart
Nike Classic Screen Swoosh D..
Add To Cart
Nike Classic Screen Swoosh D..
Athletic cut and style are always a perfect fit with the Nike Screen Swoosh Dri-Fit Tee. This lightweight short sleeve tee shows off the classic Swoosh logo in screen-printed black contrast style. The athletic cut makes it a great tee for working out. Measurements: 31" chest, 37" length. Fabric: 60%...
$28.99
Details Add To Cart
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i